PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA216G00006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 135aa    MW: 14580.3 Da    PI: 4.8106
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA216G00006genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.52.5e-5519113195
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                  vreqdr+lP+an+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfedy+eplk+yl++yre e+
  AA216G00006  19 VREQDRYLPVANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYREGEN 113
                  69*****************************************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.0E-5217119IPR009072Histone-fold
SuperFamilySSF471138.23E-4022123IPR009072Histone-fold
PfamPF008084.3E-272589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.3E-215371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.3E-217290No hitNo description
PRINTSPR006154.3E-2191109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MADMPTSPAG DGGESGGSVR EQDRYLPVAN ISRIMKKALP PNGKIGKDAK DTVQECVSEF  60
ISFITSEASD KCQKEKRKTV NGDDLLWAMA TLGFEDYLEP LKIYLARYRE GENKGSGKGD  120
GSNRDVVGGV SGQDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4818110193NF-YB
4awl_B2e-4818110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4818110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00300DAPTransfer from AT2G38880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189704.11e-88nuclear transcription factor Y subunit B-1
SwissprotQ9SLG02e-88NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBLF4ITZ41e-88F4ITZ4_ARATH; Nuclear transcription factor Y subunit B-1
STRINGscaffold_402629.14e-86(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.79e-92nuclear factor Y, subunit B1